Candidalysin Inhibits <i>Porphyromonas gingivalis</i> Lipoprotein-Induced IL-1β Production in BV-2 Microglia via Hydrophobic Microbial Interactions.
The 2 matches
- [1] § 4. Materials and Methods › 4.9. AlphaFold Predictions ↔ beta/ESMFold_advanced.ipynb, lines 99–245 · score 0.57 · amino acid sequence, best model, recycles, predicted
- [2] § 4. Materials and Methods › 4.9. AlphaFold Predictions ↔ colabfold/citations.py, lines 1–60 · score 0.55 · AlphaFold2, ColabFold, server, acid, predicted, protein
Paper
Loaded from Europe PMC by your browser, not stored by OSCR: doi.org · Europe PMC
The paper is loaded when this pane is shown.
The authors' code
Jupyter notebook · 496 lines · 17 KB · MIT · 1 match
- # %% [markdown]
- # <a href="https://colab.research.google.com/github/sokrypton/ColabFold/blob/main/beta/ESMFold_advanced.ipynb" target="_parent"><img src="https://colab.research.google.com/assets/colab-badge.svg" alt="Open In Colab"/></a>
- # %% [markdown]
- # #**ESMFold_advanced**
- # for more details see: [Github](https://github.com/facebookresearch/esm/tree/main/esm), [Preprint](https://www.biorxiv.org/content/10.1101/2022.07.20.500902v1)
- #
- # #### **Tips and Instructions**
- # - click the little ▶ play icon to the left of each cell below.
- #
- # #### **Colab Limitations**
- # - On Tesla T4 (typical free colab GPU), max total length ~ 900
- #
- # %%
- %%time
- #@title install
- #@markdown install ESMFold, OpenFold and download Params (~2min 30s)
- import os, time
- import torch
- if not os.path.isfile("esmfold.model"):
- # download esmfold params
- os.system("apt-get install aria2 -qq")
- os.system("aria2c -q -x 16 https://colabfold.steineggerlab.workers.dev/esm/esmfold.model &")
- # install libs
- print("installing libs...")
- os.system("pip install -q omegaconf pytorch_lightning biopython ml_collections einops py3Dmol modelcif")
- os.system("pip install -q git+https://github.com/NVIDIA/dllogger.git")
- print("installing openfold...")
- # install openfold
- os.system(f"pip install -q git+https://github.com/sokrypton/openfold.git")
- print("installing esmfold...")
- # install esmfold
- os.system(f"pip install -q git+https://github.com/sokrypton/esm.git@beta")
- # wait for Params to finish downloading...
- if not os.path.isfile("esmfold.model"):
- # backup source!
- os.system("aria2c -q -x 16 https://files.ipd.uw.edu/pub/esmfold/esmfold.model")
- else:
- while os.path.isfile("esmfold.model.aria2"):
- time.sleep(5)
- if "model" not in dir():
- model_path = "esmfold.model"
- model = torch.load(model_path, weights_only=False)
- model.cuda().requires_grad_(False)
- import os
- import re
- import hashlib
- import numpy as np
- import torch
- from string import ascii_uppercase, ascii_lowercase
- from jax.tree_util import tree_map
- from scipy.special import softmax
- from typing import Optional
- def get_hash(x: str) -> str:
- """Generates a SHA1 hash for a given string."""
- return hashlib.sha1(x.encode()).hexdigest()
- def parse_output(output: dict) -> dict:
- """
- Parses the raw model output dictionary to extract key metrics and structures.
- Args:
- output: The raw dictionary from model.infer().
- Returns:
- A dictionary containing pae, plddt, contacts, and xyz coordinates.
- """
- pae = (output["aligned_confidence_probs"][0] * np.arange(64)).mean(-1) * 31
- plddt = output["plddt"][0, :, 1]
- bins = np.append(0, np.linspace(2.3125, 21.6875, 63))
- sm_contacts = softmax(output["distogram_logits"], -1)[0]
- sm_contacts = sm_contacts[..., bins < 8].sum(-1)
- xyz = output["positions"][-1, 0, :, 1]
- mask = output["atom37_atom_exists"][0, :, 1] == 1
- o = {"pae": pae[mask, :][:, mask],
- "plddt": plddt[mask],
- "sm_contacts": sm_contacts[mask, :][:, mask],
- "xyz": xyz[mask]}
- if "contacts" in output["lm_output"]:
- lm_contacts = output["lm_output"]["contacts"].astype(float)[0]
- o["lm_contacts"] = lm_contacts[mask, :][:, mask]
- return o
- # --- Main Prediction Function ---
- def predict_esmfold(
- model: torch.nn.Module,
- sequence: str,
- jobname: str = "test",
- num_recycles: int = 3,
- get_LM_contacts: bool = False,
- copies: int = 1,
- chain_linker: int = 25,
- samples: Optional[int] = None,
- masking_rate: float = 0.15,
- stochastic_mode: str = "LM",
- save_dir: str = ".",
- verbose=False
- ) -> dict:
- """
- Runs ESMFold prediction for a given sequence and parameters.
- Args:
- model: The loaded ESMFold torch model.
- sequence: The amino acid sequence (e.g., "GWSTELEKH...").
- jobname: A name for the prediction job.
- num_recycles: Number of recycling iterations (0, 1, 2, 3, 6, 12).
- get_LM_contacts: Whether to return language model contacts.
- copies: Number of copies for homo-oligomeric predictions.
- chain_linker: Length of the 'X' linker for multimers.
- samples: Number of stochastic samples (None, 1, 4, 8, 16, 32, 64).
- masking_rate: Masking rate for stochastic LM sampling.
- stochastic_mode: Type of stochastic sampling ("LM", "LM_SM", "SM").
- save_dir: Directory to save PDB files and results.
- Returns:
- A dictionary containing:
- - "best_output": Raw output dictionary of the best model.
- - "best_pdb_str": PDB string of the best model (highest ptm).
- - "best_ptm": The ptm score of the best model.
- - "trajectory": A list of parsed outputs for each sample.
- - "prediction_dir": The specific directory where results were saved.
- """
- # --- Input Processing ---
- jobname = re.sub(r'\W+', '', jobname)[:50]
- # Clean sequence
- sequence = re.sub("[^A-Z:]", "", sequence.replace("/", ":").upper())
- sequence = re.sub(":+", ":", sequence)
- sequence = re.sub("^[:]+", "", sequence)
- sequence = re.sub("[:]+$", "", sequence)
- if copies <= 0:
- copies = 1
- sequence = ":".join([sequence] * copies)
- seqs = sequence.split(":")
- lengths = [len(s) for s in seqs]
- length = sum(lengths)
- if verbose:
- print(f"Running prediction for job '{jobname}' with length {length}")
- ID = jobname + "_" + get_hash(sequence)[:5]
- prediction_dir = os.path.join(save_dir, ID)
- os.makedirs(prediction_dir, exist_ok=True)
- # --- Model Configuration ---
- # Optimized for Tesla T4
- if length > 700:
- model.trunk.set_chunk_size(64)
- else:
- model.trunk.set_chunk_size(128)
- if not next(model.parameters()).is_cuda:
- print("Warning: Model is not on CUDA. Moving to CUDA.")
- model.cuda()
- model.requires_grad_(False)
- # --- Prediction Loop ---
- best_pdb_str = None
- best_ptm = 0
- best_output = None
- traj = []
- num_samples = 1 if samples is None else samples
- for seed in range(num_samples):
- torch.cuda.empty_cache()
- current_seed_str = "default"
- mask_rate = 0.0
- model.train(False) # Set to eval mode by default
- if samples is not None:
- torch.manual_seed(seed)
- current_seed_str = f"seed{seed}"
- mask_rate = masking_rate if "LM" in stochastic_mode else 0.0
- model.train("SM" in stochastic_mode) # Set to train mode for dropout
- if verbose:
- print(f"Running sample {seed + 1}/{num_samples} (seed: {current_seed_str})...")
- output = model.infer(
- sequence,
- num_recycles=num_recycles,
- chain_linker="X" * chain_linker,
- residue_index_offset=512,
- mask_rate=mask_rate,
- return_contacts=get_LM_contacts
- )
- pdb_str = model.output_to_pdb(output)[0]
- output = tree_map(lambda x: x.cpu().numpy(), output)
- ptm = output["ptm"][0]
- plddt = output["plddt"][0, :, 1].mean()
- traj.append(parse_output(output))
- if verbose:
- print(f'Sample {seed} ptm: {ptm:.3f} plddt: {plddt:.1f}')
- if ptm > best_ptm:
- best_pdb_str = pdb_str
- best_ptm = ptm
- best_output = output
- # --- Save PDB File ---
- if samples is None:
- pdb_filename = f"ptm{ptm:.3f}_r{num_recycles}_{current_seed_str}.pdb"
- else:
- pdb_filename = (
- f"ptm{ptm:.3f}_r{num_recycles}_{current_seed_str}_"
- f"{stochastic_mode}_m{masking_rate:.2f}.pdb"
- )
- pdb_path = os.path.join(prediction_dir, pdb_filename)
- with open(pdb_path, "w") as f:
- f.write(pdb_str)
- if verbose:
- print(f"Saved PDB to {pdb_path}")
- if verbose:
- print(f"Prediction complete. Best ptm: {best_ptm:.3f}")
- return {
- "output": best_output,
- "pdb_str": best_pdb_str,
- "ptm": best_ptm,
- "traj": traj,
- "dir": prediction_dir,
- "lengths":lengths
- }
- # %%
- #@title ##run **ESMFold**
- jobname = "test" #@param {type:"string"}
- sequence = "GWSTELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE" #@param {type:"string"}
- #@markdown ---
- #@markdown ###**Advanced Options**
- num_recycles = 3 #@param ["0", "1", "2", "3", "6", "12"] {type:"raw"}
- get_LM_contacts = False #@param {type:"boolean"}
- #@markdown **multimer options (experimental)**
- #@markdown - use "/" to specify chainbreaks, (eg. sequence="AAA/AAA")
- #@markdown - for homo-oligomeric predictions, set copies > 1
- copies = 1 #@param {type:"integer"}
- chain_linker = 25 #@param {type:"number"}
- #@markdown **sampling options (experimental)**
- #@markdown - Samples are generated via random masking (defined by `masking_rate`)
- #@markdown of input sequence (stochastic_mode="LM") and/or via dropout within structure module (stochastic_mode="SM").
- samples = None #@param ["None", "1", "4", "8", "16", "32", "64"] {type:"raw"}
- masking_rate = 0.15 #@param {type:"number"}
- stochastic_mode = "LM" #@param ["LM", "LM_SM", "SM"]
- o = predict_esmfold(
- model=model,
- sequence=sequence,
- jobname=jobname,
- num_recycles=num_recycles,
- get_LM_contacts=get_LM_contacts,
- copies=copies,
- chain_linker=chain_linker,
- samples=samples,
- masking_rate=masking_rate,
- stochastic_mode=stochastic_mode)
- # %%
- #@title display (optional) {run: "auto"}
- #@markdown Note: If samples selected, the model with max pTM is displayed.
- import py3Dmol
- pymol_color_list = ["#33ff33","#00ffff","#ff33cc","#ffff00","#ff9999","#e5e5e5","#7f7fff","#ff7f00",
- "#7fff7f","#199999","#ff007f","#ffdd5e","#8c3f99","#b2b2b2","#007fff","#c4b200",
- "#8cb266","#00bfbf","#b27f7f","#fcd1a5","#ff7f7f","#ffbfdd","#7fffff","#ffff7f",
- "#00ff7f","#337fcc","#d8337f","#bfff3f","#ff7fff","#d8d8ff","#3fffbf","#b78c4c",
- "#339933","#66b2b2","#ba8c84","#84bf00","#b24c66","#7f7f7f","#3f3fa5","#a5512b"]
- def show_pdb(pdb_str, show_sidechains=False, show_mainchains=False,
- color="pLDDT", chains=None, vmin=50, vmax=90,
- size=(800,480), hbondCutoff=4.0,
- Ls=None,
- animate=False):
- if chains is None:
- chains = 1 if Ls is None else len(Ls)
- view = py3Dmol.view(js='https://3dmol.org/build/3Dmol.js', width=size[0], height=size[1])
- if animate:
- view.addModelsAsFrames(pdb_str,'pdb',{'hbondCutoff':hbondCutoff})
- else:
- view.addModel(pdb_str,'pdb',{'hbondCutoff':hbondCutoff})
- if color == "pLDDT":
- view.setStyle({'cartoon': {'colorscheme': {'prop':'b','gradient': 'roygb','min':vmin,'max':vmax}}})
- elif color == "rainbow":
- view.setStyle({'cartoon': {'color':'spectrum'}})
- elif color == "chain":
- for n,chain,color in zip(range(chains),alphabet_list,pymol_color_list):
- view.setStyle({'chain':chain},{'cartoon': {'color':color}})
- if show_sidechains:
- BB = ['C','O','N']
- view.addStyle({'and':[{'resn':["GLY","PRO"],'invert':True},{'atom':BB,'invert':True}]},
- {'stick':{'colorscheme':f"WhiteCarbon",'radius':0.3}})
- view.addStyle({'and':[{'resn':"GLY"},{'atom':'CA'}]},
- {'sphere':{'colorscheme':f"WhiteCarbon",'radius':0.3}})
- view.addStyle({'and':[{'resn':"PRO"},{'atom':['C','O'],'invert':True}]},
- {'stick':{'colorscheme':f"WhiteCarbon",'radius':0.3}})
- if show_mainchains:
- BB = ['C','O','N','CA']
- view.addStyle({'atom':BB},{'stick':{'colorscheme':f"WhiteCarbon",'radius':0.3}})
- view.zoomTo()
- if animate: view.animate()
- return view
- color = "confidence" #@param ["confidence", "rainbow", "chain"]
- if color == "confidence": color = "pLDDT"
- show_sidechains = False #@param {type:"boolean"}
- show_mainchains = False #@param {type:"boolean"}
- show_pdb(o["pdb_str"], color=color,
- show_sidechains=show_sidechains,
- show_mainchains=show_mainchains,
- Ls=o["lengths"]).show()
- # %%
- #@title plot confidence (optional)
- #@markdown Note: If samples selected, the model with max pTM is displayed.
- dpi = 100 #@param {type:"integer"}
- import matplotlib.pyplot as plt
- def plot_ticks(Ls):
- Ln = sum(Ls)
- L_prev = 0
- for L_i in Ls[:-1]:
- L = L_prev + L_i
- L_prev += L_i
- plt.plot([0,Ln],[L,L],color="black")
- plt.plot([L,L],[0,Ln],color="black")
- ticks = np.cumsum([0]+Ls)
- ticks = (ticks[1:] + ticks[:-1])/2
- plt.yticks(ticks,alphabet_list[:len(ticks)])
- def plot_confidence(output, Ls=None, dpi=100):
- O = parse_output(output)
- if "lm_contacts" in O:
- plt.figure(figsize=(20,4), dpi=dpi)
- plt.subplot(1,4,1)
- else:
- plt.figure(figsize=(15,4), dpi=dpi)
- plt.subplot(1,3,1)
- plt.title('Predicted lDDT')
- plt.plot(O["plddt"])
- if Ls is not None:
- L_prev = 0
- for L_i in Ls[:-1]:
- L = L_prev + L_i
- L_prev += L_i
- plt.plot([L,L],[0,100],color="black")
- plt.xlim(0,O["plddt"].shape[0])
- plt.ylim(0,100)
- plt.ylabel('plDDT')
- plt.xlabel('position')
- plt.subplot(1,4 if "lm_contacts" in O else 3,2)
- plt.title('Predicted Aligned Error')
- Ln = O["pae"].shape[0]
- plt.imshow(O["pae"],cmap="bwr",vmin=0,vmax=30,extent=(0, Ln, Ln, 0))
- if Ls is not None and len(Ls) > 1: plot_ticks(Ls)
- plt.colorbar()
- plt.xlabel('Scored residue')
- plt.ylabel('Aligned residue')
- if "lm_contacts" in O:
- plt.subplot(1,4,3)
- plt.title("contacts from LM")
- plt.imshow(O["lm_contacts"],cmap="Greys",vmin=0,vmax=1,extent=(0, Ln, Ln, 0))
- if Ls is not None and len(Ls) > 1: plot_ticks(Ls)
- plt.subplot(1,4,4)
- else:
- plt.subplot(1,3,3)
- plt.title("contacts from Structure Module")
- plt.imshow(O["sm_contacts"],cmap="Greys",vmin=0,vmax=1,extent=(0, Ln, Ln, 0))
- if Ls is not None and len(Ls) > 1: plot_ticks(Ls)
- return plt
- plot_confidence(o["output"], Ls=o["lengths"], dpi=dpi)
- plt.show()
- # %%
- #@title download predictions
- from google.colab import files
- os.system(f"zip {o['dir']}.zip {o['dir']}/*")
- files.download(f"{o['dir']}.zip")
- # %%
- #@title animate outputs (optional)
- #@markdown if more than one sample generated
- import os
- if not os.path.isdir("colabfold"):
- os.system("git clone https://github.com/sokrypton/ColabFold.git")
- import ColabFold.beta.colabfold as cf
- dpi = 100#@param {type:"integer"}
- color_by_plddt = True #@param {type:"boolean"}
- use_pca = True
- cycle = True
- import matplotlib
- from matplotlib import animation
- from IPython.display import HTML
- from sklearn.decomposition import PCA
- def mk_animation(xyz, labels, plddt, ref=0, Ls=None, line_w=2.0, dpi=100,color_by_plddt=False):
- def ca_align_to_last(positions, ref):
- def align(P, Q):
- if Ls is None or len(Ls) == 1:
- P_,Q_ = P,Q
- else:
- # align relative to first chain
- P_,Q_ = P[:Ls[0]],Q[:Ls[0]]
- p = P_ - P_.mean(0,keepdims=True)
- q = Q_ - Q_.mean(0,keepdims=True)
- return ((P - P_.mean(0,keepdims=True)) @ cf.kabsch(p,q)) + Q_.mean(0,keepdims=True)
- pos = positions[ref] - positions[ref].mean(0,keepdims=True)
- best_2D_view = pos @ cf.kabsch(pos,pos,return_v=True)
- new_positions = []
- for i in range(len(positions)):
- new_positions.append(align(positions[i],best_2D_view))
- return np.asarray(new_positions)
- # align to reference
- pos = ca_align_to_last(xyz, ref)
- fig, (ax1) = plt.subplots(1)
- fig.set_figwidth(5)
- fig.set_figheight(5)
- fig.set_dpi(dpi)
- xy_min = pos[...,:2].min() - 1
- xy_max = pos[...,:2].max() + 1
- for ax in [ax1]:
- ax.set_xlim(xy_min, xy_max)
- ax.set_ylim(xy_min, xy_max)
- ax.axis(False)
- ims=[]
- for l,pos_,plddt_ in zip(labels,pos,plddt):
- if color_by_plddt:
- img = cf.plot_pseudo_3D(pos_, c=plddt_, cmin=50, cmax=90, line_w=line_w, ax=ax1)
- elif Ls is None or len(Ls) == 1:
- img = cf.plot_pseudo_3D(pos_, ax=ax1, line_w=line_w)
- else:
- c = np.concatenate([[n]*L for n,L in enumerate(Ls)])
- img = cf.plot_pseudo_3D(pos_, c=c, cmap=cf.pymol_cmap, cmin=0, cmax=39, line_w=line_w, ax=ax1)
- ims.append([cf.add_text(f"{l}", ax1),img])
- ani = animation.ArtistAnimation(fig, ims, blit=True, interval=120)
- plt.close()
- return ani.to_html5_video()
- labels = np.array([f"seed:{x}" for x in range(len(o["traj"]))])
- pos = np.array([x["xyz"] for x in o["traj"]])
- plddt = np.array([x["plddt"] for x in o["traj"]])
- if use_pca and pos.shape[0] > 1:
- pos_ca = pos
- if o["lengths"] is not None and len(o["lengths"]) > 1:
- pos_ca = pos_ca[:,:o["lengths"][0]]
- i,j = np.triu_indices(pos_ca.shape[1],k=1)
- pos_ca_dm = np.sqrt(np.square(pos_ca[:,None,:,:] - pos_ca[:,:,None]).sum(-1))[:,i,j]
- pc = PCA(1).fit_transform(pos_ca_dm)[:,0].argsort()
- if cycle:
- pc = np.append(pc,pc[1:-1][::-1])
- pos = pos[pc]
- labels = labels[pc]
- plddt = plddt[pc]
- HTML(mk_animation(pos, labels, plddt, Ls=o["lengths"], dpi=dpi, color_by_plddt=color_by_plddt))
ESMFold_advanced.ipynb at commit efbf31c, under MIT · at the source
Overview
- School of Pharmacy, Yasuda Women’s University, Hiroshima 731-0153, (A.K.); (N.M.); (K.S.); (M.U.); (A.N.); (M.E.); (R.O.)
- Laboratory of Molecular Pathobiology, Faculty of Pharmaceutical Sciences, Suzuka University of Medical Science, Mie 513-8670, Japan
- Department of Pharmaceutical Sciences, School of Pharmacy at Fukuoka, International University of Health and Welfare, Fukuoka 831-8501, Japan
- Department of Pharmacotherapeutics, Faculty of Pharmacy and Pharmaceutical Sciences, Fukuyama University, Hiroshima 729-0292, Japan
- Department of Pharmacology, Faculty of Pharmacy, Yasuda Women’s University, Hiroshima 731-0153, Japan
Abstract
In postmortem Alzheimer’s disease (AD) brains, Porphyromonas gingivalis (Pg), a major periodontal pathogen, and Candida albicans, one of the most common fungal pathogens, have been detected. Although it is important to better understand the effects of their co-infection in the brain for elucidating the pathogenesis of AD, little is known about the neuropathological significance of such co-infection. In the present study, we aimed to elucidate the effects of co-exposure to virulence factors derived from Pg and C. albicans on microglial inflammatory responses. We demonstrated, for the first time, that both candidalysin dissolved in dimethyl sulfoxide (CLd) and water (CLw) significantly suppressed Pg lipopolysaccharide (LPS)-induced interleukin-1β (IL-1β) production by 35–60% and nuclear factor-κB (NF-κB) activation by 20–40%. It should be noted that contaminating Pg outer membrane lipoproteins in Pg LPS were mainly responsible for IL-1β production. To examine the possible hydrophobic interactions between lipoproteins contaminating the Pg LPS preparation and CL, we used 8-anilino-1-naphthalenes
Reproduced under the paper's license (CC BY), from the paper cited above.
Repository
Its files are read in the Code ↔ Paper reader above, with 2 matches between paragraphs and lines of code.
sokrypton/colabfold
efbf31c37cedb38cd09c69c1b991910a9866480e, 19 September 2026Availability: 1 check, the latest on 27 September 2026: the link answers
- 27 September 2026: the link answers
64 files
- AlphaFold2.ipynb, Jupyter, 498 lines
- AlphaFold3_of3.ipynb, Jupyter, 554 lines
- BioEmu.ipynb, Jupyter, 390 lines
- Boltz1.ipynb, Jupyter, 258 lines
- ColabFold2_preview.ipynb
, Jupyter, 666 lines - ESMFold.ipynb, Jupyter, 265 lines
- MsaServer/
restart-systemd.sh , Shell, 5 lines - MsaServer/
setup-and-start-local.sh , Shell, 111 lines - RoseTTAFold.ipynb, Jupyter, 213 lines
- RoseTTAFold2.ipynb, Jupyter, 411 lines
- batch/
AlphaFold2_batch.ipynb , Jupyter, 180 lines - beta/
AlphaFold2_advanced.ipyn , Jupyter, 615 linesb - beta/
AlphaFold2_advanced_beta , Jupyter, 7 lines.ipynb - beta/
AlphaFold2_advanced_old. , Jupyter, 1,021 linesipynb - beta/
AlphaFold2_complexes.ipy , Jupyter, 514 linesnb - beta/
AlphaFold_wJackhmmer.ipy , Jupyter, 697 linesnb - beta/
Alphafold_single.ipynb , Jupyter, 207 lines - beta/
ESMFold.ipynb , Jupyter, 385 lines - beta/
ESMFold_advanced.ipynb , Jupyter, 496 lines, 1 match - beta/
ESMFold_api.ipynb , Jupyter, 104 lines - beta/
RoseTTAFold.ipynb , Jupyter, 300 lines - beta/
RoseTTAFold_install.sh , Shell, 5 lines - beta/
RoseTTAFold_run.sh , Shell, 26 lines - beta/
alphafold_output_at_each , Jupyter, 152 lines_recycle.ipynb - beta/
colabfold.py , Python, 711 lines - beta/
colabfold_alphafold.py , Python, 821 lines - beta/
convert_256_to_384_rep.i , Jupyter, 39 linespynb - beta/
omegafold.ipynb , Jupyter, 167 lines - beta/
omegafold_hacks.ipynb , Jupyter, 206 lines - beta/
pairmsa.py , Python, 237 lines - beta/
relax_amber.ipynb , Jupyter, 154 lines - colabfold/
__init__.py , Python, 1 line - colabfold/
alphafold/ , Python, 1 line__init__.py - colabfold/
alphafold/ , Python, 435 linesextra_ptm.py - colabfold/
alphafold/ , Python, 98 linesipsae.py - colabfold/
alphafold/ , Python, 277 linesmodels.py - colabfold/
alphafold/ , Python, 44 linesmsa.py - colabfold/
batch.py , Python, 2,364 lines - colabfold/
citations.py , Python, 160 lines, 1 match - colabfold/
colabfold.py , Python, 831 lines - colabfold/
download.py , Python, 140 lines - colabfold/
input.py , Python, 414 lines - colabfold/
mmseqs/ , Python, 1 line__init__.py - colabfold/
mmseqs/ , Python, 63 linesmerge_and_split_msas.py - colabfold/
mmseqs/ , Python, 640 linessearch.py - colabfold/
mmseqs/ , Python, 55 linessplit_msas.py - colabfold/
pdb.py , Python, 69 lines - colabfold/
plot.py , Python, 158 lines - colabfold/
relax.py , Python, 108 lines - colabfold/
utils.py , Python, 406 lines - colabfold_search.sh, Shell, 68 lines
- setup_databases.sh, Shell, 218 lines
- tests/
__init__.py , Python, 1 line - tests/
mock.py , Python, 230 lines - tests/
reindent_ipynb.py , Python, 8 lines - tests/
test_colabfold.py , Python, 510 lines - tests/
test_msa.py , Python, 40 lines - tests/
test_utils.py , Python, 141 lines - utils/
convert_deepfold_weights , Python, 9 lines.py - utils/
plot_scores.ipynb , Jupyter, 28 lines - verbose/
alphafold_noTemplates_no , Jupyter, 267 linesMD.ipynb - verbose/
alphafold_noTemplates_ye , Jupyter, 323 linessMD.ipynb - LICENSE, License, 21 lines
- README.md, Text, 293 lines
Tracing map
Proposed by the machine: these links were found in the paper and verified at the source, without human review. The map will receive a Zenodo DOI once one of the paper's authors has validated it with their ORCID.
What the map holds:
- 1 repository of the authors' code, each at its verified commit, with its license and how the link was found in the paper;
- 62 scripts, each with its path and the digest of its content;
- 2 matches between paragraphs of the paper and lines of the code (method lexical-v1);
- neither the text of the paper nor the code itself.
Its JSON (tracing-map.json) is deposited on Zenodo with its DOI once the map is validated.
Data
No dataset and no data link were found in the paper.
Data Availability Statement
The original contributions presented in this study are included in the article. Further inquiries can be directed to the corresponding author.
Reproduced under the paper's license (CC BY), from the paper cited above.
Versions
The history of this record: each version stored by the harvester or made by a correction of its authors or of the maintainers of its code, and what changed in its facts. The texts of the paper (its abstract, its availability statements) are not part of it; versions that changed only those are not listed.
Version 1, 27 September 2026: the first record
Recorded: type, language, journal, volume, issue, pages, dates, 12 authors, 9 keywords, 10 MeSH terms, 1 funder, 35 references.
Cite
This paper
Kanagawa, H., Kawahara, A., Mikawa, N., Sugihara, K., Ueda, M., Nitta, A., Egi, M., Oda, R., Nonaka, S., Tozaki-Saitoh, H., Oda, K., & Nakanishi, H. (2026). Candidalysin Inhibits &
BibTeX
@article{kanagawa2026can
author = {Kanagawa, Haruka and Kawahara, Ayaka and Mikawa, Nene and Sugihara, Kana and Ueda, Momoha and Nitta, Ayano and Egi, Mizuki and Oda, Reina and Nonaka, Saori and Tozaki-Saitoh, Hidetoshi and Oda, Kosuke and Nakanishi, Hiroshi},
title = {{Candidalysin Inhibits \&
journal = {International journal of molecular sciences},
year = {2026},
month = jul,
volume = {27},
number = {15},
pages = {6614},
publisher = {Multidisciplinary Digital Publishing Institute (MDPI)},
issn = {1422-0067},
doi = {10.3390/
url = {https://
pmid = {42589276},
pmcid = {PMC13466725}
}
RIS
TY - JOUR
AU - Kanagawa, Haruka
AU - Kawahara, Ayaka
AU - Mikawa, Nene
AU - Sugihara, Kana
AU - Ueda, Momoha
AU - Nitta, Ayano
AU - Egi, Mizuki
AU - Oda, Reina
AU - Nonaka, Saori
AU - Tozaki-Saitoh, Hidetoshi
AU - Oda, Kosuke
AU - Nakanishi, Hiroshi
TI - Candidalysin Inhibits &
T2 - International journal of molecular sciences
J2 - Int J Mol Sci
PY - 2026
DA - 2026/
VL - 27
IS - 15
SP - 6614
SN - 1422-0067
PB - Multidisciplinary Digital Publishing Institute (MDPI)
DO - 10.3390/
UR - https://
LA - en
ER -
CSL-JSON
{
"id": "10.3390/
"type": "article-journal",
"title": "Candidalysin Inhibits &
"container-title": "International journal of molecular sciences",
"author": [
{
"family": "Kanagawa",
"given": "Haruka"
},
{
"family": "Kawahara",
"given": "Ayaka"
},
{
"family": "Mikawa",
"given": "Nene"
},
{
"family": "Sugihara",
"given": "Kana"
},
{
"family": "Ueda",
"given": "Momoha"
},
{
"family": "Nitta",
"given": "Ayano"
},
{
"family": "Egi",
"given": "Mizuki"
},
{
"family": "Oda",
"given": "Reina"
},
{
"family": "Nonaka",
"given": "Saori"
},
{
"family": "Tozaki-Saitoh",
"given": "Hidetoshi"
},
{
"family": "Oda",
"given": "Kosuke"
},
{
"family": "Nakanishi",
"given": "Hiroshi"
}
],
"container-title-short":
"volume": "27",
"issue": "15",
"page": "6614",
"DOI": "10.3390/
"PMID": "42589276",
"PMCID": "PMC13466725",
"ISSN": "1422-0067",
"publisher": "Multidisciplinary Digital Publishing Institute (MDPI)",
"URL": "https://
"language": "en",
"issued": {
"date-parts": [
[
2026,
7,
24
]
]
}
}
The tracing map gets a citation of its own once an author has validated it and it has a DOI.
Similar papers
The papers with a page that share the most with this one: the tools found in their code, their categories, datasets, cited references and authors, the rarest counting most.
- [1] doi:10.1038/s41586-026-10391-0 [code]
- Cell-type-targeted mitochondrial transplantation rescues cell degeneration.Journal: NatureIn common: RDKit, JAX, PyTorch Lightning, 9 other tools, mouse, cellular / molecular, 1 reference
- [2] doi:10.1038/s41598-026-53415-5 [code]
- Computational design and immunoinformatics validation of a T cell multi-epitope vaccine targeting glioblastoma stem cells.Journal: Scientific reportsIn common: RDKit, JAX, PyTorch Lightning, 9 other tools, cellular / molecular, 1 reference
- [3] doi:10.1021/acs.biochem.5c00596 [code]
- Cargo Recognition of Nesprin-2 by the Dynein Adapter Bicaudal D2 for a Nuclear Positioning Pathway That Is Important for Brain Development.Journal: BiochemistryIn common: RDKit, JAX, PyTorch Lightning, 9 other tools, cellular / molecular, 1 reference
- [4] doi:10.1038/s42003-026-10957-8 [code]
- Brain defence by the extracellular matrix protein Cochlin.Journal: Communications biologyIn common: RDKit, JAX, PyTorch Lightning, 8 other tools, mouse, cellular / molecular
- [5] doi:10.1016/j.molcel.2026.07.006 [code]
- DeorphaNN: Virtual screening of GPCR peptide agonists using AlphaFold-predicted active-state complexes and deep learning embeddings.Journal: Molecular cellIn common: JAX, Biopython, PyTorch Geometric, 7 other tools, cellular / molecular, 1 reference
- [6] doi:10.1021/acsomega.5c09368 [code]
- Structure-Based and AI-Assisted Identification of AGPS Inhibitors for Glioma via Integrated Docking, Molecular Dynamics, and Binding Affinity Screening.Journal: ACS omegaIn common: RDKit, Biopython, PyTorch Geometric, 6 other tools
- [7] doi:10.1523/eneuro.0362-25.2026 [code]
- Similarities between &
lt;i& gt;Ciona& lt;/ i& gt; Dorsal Motor Ganglion and Vertebrate Cerebellum: Did a Chordate Ancestor Already Show D/ V Subdivision within a Hindbrain Precursor? Journal: eNeuroIn common: PyTorch Lightning, Biopython, PyTorch Geometric, 6 other tools - [8] doi:10.1093/nar/gkag706 [code]
- scDifformer: diffusion-based post-training for virtual cell modeling across large-scale single-cell data.Journal: Nucleic acids researchIn common: RDKit, PyTorch Geometric, TensorFlow, 6 other tools
- [9] doi:10.1038/s41467-026-71391-2 [code]
- Accelerating Leigh syndrome drug discovery through deep learning screening in brain organoids.Journal: Nature communicationsIn common: PyTorch Lightning, PyTorch Geometric, TensorFlow, 6 other tools
- [10] doi:10.1038/s41467-026-75444-4 [code]
- Structural insights enable drug discovery for the neuronal NBCn2 carbonate transporter.Journal: Nature communicationsIn common: RDKit, JAX, Biopython, 4 other tools, mouse, cellular / molecular
Contribute
The authors of this paper can claim it, correct its record and validate its tracing map, and the maintainers of its code (its owner, or a public member of its organization) correct what it says of their repository; anyone signed in can ask for its removal. Every request goes to OSCR's own machine, which answers it; your account page follows them.
Sign in with ORCID to claim this paper as one of its authors, correct its record or validate its tracing map: when the paper's metadata lists your ORCID iD, you are recognized at once. Maintainers of its code: sign in with GitHub, then claim the repository on your account page.
Claim this paper
Correct its record
Say what each link of this record is, remove the ones that are not the paper's, add the ones that are missing. The correction becomes a new version of the record, in its Versions section.
Validate its tracing map
You validate the map as this page shows it: 1 repository of the authors' code, each at its verified commit and with its license, 62 scripts, and 2 matches between paragraphs and code (see the Code and Map sections). It then receives a DOI on Zenodo, with you (your ORCID iD) and OSCR as its creators; the code itself is not deposited.
The map's fingerprint: sha256:5db95928d9de838a…
Add the badge to its README
The badge links the code to this page. Copy one of these into the README of the paper's code: only you decide where it goes, and nothing is changed for you.
Markdown
[, paste the snippet at the top, then “Commit changes…” and, to review it first, “Create a new branch and start a pull request”. You open the pull request; OSCR asks for no permission.
Request its removal
To ask OSCR to remove this record, the copies of its authors' scripts or its tracing map, use the removal request page: signed in, you say who you are, what to remove and why, then review and confirm the request. Published rules decide every request (how).
Discussion, reproductions, activity
Discussion: questions and error reports about this paper and its code, from signed-in readers and its authors. It opens with sign-in.
Reproductions: reports from readers who ran the authors' code: what they reproduced, with which environment, commit and data. It opens with sign-in.
Activity: what happens around this paper: new versions of its record, its map's validation, discussions and reproductions. It opens with sign-in.
